PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN38134.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family Dof
Protein Properties Length: 445aa    MW: 49203.1 Da    PI: 7.6694
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN38134.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof1191.8e-3784142361
      zf-Dof   3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61 
                 +k l+cprC+s++tkfCy+nny+++qPr+fCk+C+ryWt+GG++rnvP+G+g+rknk+s
  KHN38134.1  84 NKVLPCPRCNSSETKFCYFNNYNVNQPRHFCKNCQRYWTAGGTIRNVPLGAGKRKNKHS 142
                 67899****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074781.0E-2772140IPR003851Zinc finger, Dof-type
PfamPF027013.6E-3185141IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.41687141IPR003851Zinc finger, Dof-type
PROSITE patternPS01361089125IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 445 aa     Download sequence    Send to blast
MHILCQPLHS VRNGLQESTN DEVDVPLNEV SSKQIDPQED GNSAPNIYKN PTLKLVAKVV  60
NGNNEHRNAK RDIDHQEKVL KRANKVLPCP RCNSSETKFC YFNNYNVNQP RHFCKNCQRY  120
WTAGGTIRNV PLGAGKRKNK HSTLQYCLIP VTPDAASVSQ TDSKPASDML LSSSRLIKGM  180
ENISSLREET PLSESLETVL SLNGQTNIEM ASSTLKDDAE ESSCSSMRSN EVEQVCLAQH  240
SLVPLQSFQY YPVPSWSYQW NPCWNVKELR PRSLSSRPVY TGSPTMIAVP GFSLPTVILP  300
GVPYSYSGFM SNWDEQKEDA SLVGSAFSGI SLSPSSVSNS TCSGNRSPTL GKHSRDGSTL  360
GEDAMKQNLW VPKTVRINDP EEAANSSIWS TLGTKSEQNK LIMKGSIFKS FEPKASASSH  420
ILEDNQILRA NPAAFSRSES FQESM
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006585698.10.0PREDICTED: cyclic dof factor 3-like isoform X1
TrEMBLA0A0B2S1370.0A0A0B2S137_GLYSO; Dof zinc finger protein DOF5.2
STRINGGLYMA08G24591.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF35023165
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G47500.16e-58cycling DOF factor 3
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]